Test 'UnitTests' for Revision 55917
GitHub link: 1423e58435b3c77acfd76c142d855ed5855e73a5

Test id:    65413  <-- send this for tech support
Test name:  UnitTests
Log file:   [log]
YAML file:  [yaml]
Test files: [files list view]  [files, file-system-like view]  You can see 'diff' results for tests files from two different revisions here.
Started:    2013-10-21 01:43
Finished:   2013-10-21 01:50
Test Log [Original unformated log] -------------------------------

Running one suite: InterchainPairEnergy
Test suite: InterchainPairEnergy (test/protocols/scoring/InterchainPairEnergy.cxxtest.hh)

Running one suite: LoopTest
Test suite: LoopTest (test/protocols/loops/Loop.cxxtest.hh)

Running one suite: JD2ResourceManagerJobInputterMultipleJobTagsTests
Test suite: JD2ResourceManagerJobInputterMultipleJobTagsTests (test/protocols/jd2/JD2ResourceManagerJobInputterMultipleJobTags.cxxtest.hh)

Running one suite: OccupiedSpaceHashTests
Test suite: OccupiedSpaceHashTests (test/protocols/match/OccupiedSpaceHash.cxxtest.hh)

Running one suite: JD2ResourceManagerJobInputterSimplifiedInputTests
Test suite: JD2ResourceManagerJobInputterSimplifiedInputTests (test/protocols/jd2/JD2ResourceManagerJobInputterSimplifiedInput.cxxtest.hh)

Running one suite: LigandConformerTests
Test suite: LigandConformerTests (test/protocols/match/LigandConformer.cxxtest.hh)

Running one suite: RestrictToCDRH3LoopTest
Test suite: RestrictToCDRH3LoopTest (test/protocols/toolbox/task_operations/RestrictToCDRH3Loop.cxxtest.hh)

Running one suite: CM_Util_Tests
Test suite: CM_Util_Tests (test/protocols/comparative_modeling/util.cxxtest.hh)

Running one suite: GrowRightTests
Test suite: GrowRightTests (test/protocols/forge/build/GrowRight.cxxtest.hh)

Running one suite: SegmentInsertTests
Test suite: SegmentInsertTests (test/protocols/forge/build/SegmentInsert.cxxtest.hh)

Running one suite: ReplicateFilterTests
Test suite: ReplicateFilterTests (test/protocols/filters/ReplicateFilter.cxxtest.hh)

Running one suite: GrowLeftTests
Test suite: GrowLeftTests (test/protocols/forge/build/GrowLeft.cxxtest.hh)

Running one suite: ProteinInterfaceDesignTests
Test suite: ProteinInterfaceDesignTests (test/protocols/protein_interface_design/protein_interface_design.cxxtest.hh)

Running one suite: RestrictNonSurfaceToRepackingOperationTests
Test suite: RestrictNonSurfaceToRepackingOperationTests (test/protocols/toolbox/task_operations/RestrictNonSurfaceToRepackingOperation.cxxtest.hh)

Running one suite: LoopsFileIOTest
Test suite: LoopsFileIOTest (test/protocols/loops/LoopsFileIO.cxxtest.hh)

Running one suite: PredockRotCenterTest
Test suite: PredockRotCenterTest (test/protocols/enzdes/PredockRotCenter.cxxtest.hh)

Running one suite: ExtraThreadingMover_Tests
Test suite: ExtraThreadingMover_Tests (test/protocols/comparative_modeling/ExtraThreadingMover.cxxtest.hh)

Running one suite: EntityCorrespondenceTests
Test suite: EntityCorrespondenceTests (test/protocols/pack_daemon/EntityCorrespondence.cxxtest.hh)

Running one suite: NonlocalUtilTest
Test suite: NonlocalUtilTest (test/protocols/nonlocal/NonlocalUtil.cxxtest.hh)

Running one suite: CoordSerializationTests
Test suite: CoordSerializationTests (test/protocols/features/CoordSerializationTests.cxxtest.hh)

Running one suite: InterfaceTest
Test suite: InterfaceTest (test/protocols/scoring/Interface.cxxtest.hh)

Running one suite: fold_tree_functions_Tests
Test suite: fold_tree_functions_Tests (test/protocols/forge/methods/fold_tree_functions.cxxtest.hh)

Running one suite: cout_io
Test suite: cout_io (test/protocols/util/cout.cxxtest.hh)

Running one suite: TaskAwareMinMoverTests
Test suite: TaskAwareMinMoverTests (test/protocols/moves/TaskAwareMinMover.cxxtest.hh)

Running one suite: RigidLigandBuilderTests
Test suite: RigidLigandBuilderTests (test/protocols/match/RigidLigandBuilder.cxxtest.hh)

Running one suite: AtomCoordinateCstMoverTests
Test suite: AtomCoordinateCstMoverTests (test/protocols/relax/AtomCoordinateCstMover.cxxtest.hh)

Running one suite: JD2ResourceManagerJobInputterTests
Test suite: JD2ResourceManagerJobInputterTests (test/protocols/jd2/JD2ResourceManagerJobInputter.cxxtest.hh)

Running one suite: PointMutScanDriverTests
Test suite: PointMutScanDriverTests (test/protocols/pmut_scan/PointMutScanDriver.cxxtest.hh)

Running one suite: JumpingTest
Test suite: JumpingTest (test/protocols/jumping/JumpSetup.cxxtest.hh)

Running one suite: HasherTests

Running one suite: TorsionBinIOTests
Test suite: HasherTests (test/protocols/match/Hasher.cxxtest.hh)
Test suite: TorsionBinIOTests (test/protocols/frag_picker/TorsionBinIO.cxxtest.hh)

Running one suite: VoxelSetIteratorTests
Test suite: VoxelSetIteratorTests (test/protocols/match/VoxelSetIterator.cxxtest.hh)

Running one suite: BluePrintTests
Test suite: BluePrintTests (test/protocols/jd2/parser/BluePrint.cxxtest.hh)

Running one suite: LoopsFoldTreeTest
Test suite: LoopsFoldTreeTest (test/protocols/loops/LoopsFoldTree.cxxtest.hh)

Running one suite: LoopsFileLoaderTest
Test suite: LoopsFileLoaderTest (test/protocols/loops/LoopsFileLoader.cxxtest.hh)

Running one suite: WobbleMoverTest
Test suite: WobbleMoverTest (test/protocols/abinitio/WobbleMover.cxxtest.hh)

Running one suite: RegionTest
Test suite: RegionTest (test/protocols/nonlocal/Region.cxxtest.hh)

Running one suite: ExternalGeomSamplerTests
Test suite: ExternalGeomSamplerTests (test/protocols/match/ExternalGeomSampler.cxxtest.hh)

Running one suite: IfThenFilterTests
Test suite: IfThenFilterTests (test/protocols/filters/BasicFilters.cxxtest.hh)

Running one suite: RotateJumpAxisMoverTests
Test suite: RotateJumpAxisMoverTests (test/protocols/rigid/RotateJumpAxisMover.cxxtest.hh)

Running one suite: APClusterTest
Test suite: APClusterTest (test/protocols/cluster/APCluster.cxxtest.hh)

Running one suite: ProteinSCSamplerTests
Test suite: ProteinSCSamplerTests (test/protocols/match/ProteinSCSampler.cxxtest.hh)

Running one suite: ScoreTest
Test suite: ScoreTest (test/protocols/moves/ScoreTest.cxxtest.hh)

Running one suite: ResidueCountFilterTests
Test suite: ResidueCountFilterTests (test/protocols/simple_filters/ResidueCountFilter.cxxtest.hh)

Running one suite: SegmentRebuildTests
Test suite: SegmentRebuildTests (test/protocols/forge/build/SegmentRebuild.cxxtest.hh)

Running one suite: JD2ResourceManagerTests
Test suite: JD2ResourceManagerTests (test/protocols/jd2/JD2ResourceManager.cxxtest.hh)

Running one suite: RestrictOperationsTests
Test suite: RestrictOperationsTests (test/protocols/toolbox/task_operations/RestrictOperations.cxxtest.hh)

Running one suite: ScaffoldBuildPointTests
Test suite: ScaffoldBuildPointTests (test/protocols/match/ScaffoldBuildPoint.cxxtest.hh)

Running one suite: ContainerMoversTest
Test suite: ContainerMoversTest (test/protocols/moves/MoverContainer.cxxtest.hh)

Running one suite: FragmentCandidatesTests
Test suite: FragmentCandidatesTests (test/protocols/frag_picker/FragmentCandidatesTests.cxxtest.hh)

Running one suite: GunnCostTest
Test suite: GunnCostTest (test/protocols/abinitio/GunnCost.cxxtest.hh)

Running one suite: DsspTests
Test suite: DsspTests (test/protocols/jumping/Dssp.cxxtest.hh)

Running one suite: EntityTests
Test suite: EntityTests (test/protocols/genetic_algorithm/Entity.cxxtest.hh)

Running one suite: PlainSilentFileJobDistributorTest
Test suite: PlainSilentFileJobDistributorTest (test/protocols/jobdist/PlainSilentFileJobDistributor.cxxtest.hh)

Running one suite: ShearMoverTest
Test suite: ShearMoverTest (test/protocols/moves/ShearMover.cxxtest.hh)

Running one suite: LoopsUtilTest
Test suite: LoopsUtilTest (test/protocols/loops/LoopsUtil.cxxtest.hh)

Running one suite: PackDaemonTest
Test suite: PackDaemonTest (test/protocols/pack_daemon/PackDaemon.cxxtest.hh)
~DoubleLazyIG: used 0 bytes instead of 19056
~DoubleLazyIG: used 6096 bytes instead of 19056
~DoubleLazyIG: used 8524 bytes instead of 24872

Running one suite: LoopsFileOptionsTest
Test suite: LoopsFileOptionsTest (test/protocols/loops/LoopsFileOptions.cxxtest.hh)

Running one suite: BetaTurnDetectionFeaturesTest
Test suite: BetaTurnDetectionFeaturesTest (test/protocols/features/BetaTurnDetectionFeatures.cxxtest.hh)

Running one suite: BuildManagerTests
Test suite: BuildManagerTests (test/protocols/forge/build/BuildManager.cxxtest.hh)

Running one suite: BumpGridTests
Test suite: BumpGridTests (test/protocols/match/BumpGrid.cxxtest.hh)

Running one suite: VicinitySamplingKinematicPerturberTests
Test suite: VicinitySamplingKinematicPerturberTests (test/protocols/moves/kinematic_closure/VicinitySamplingKinematicPerturber.cxxtest.hh)

Running one suite: BridgeTests
Test suite: BridgeTests (test/protocols/forge/build/Bridge.cxxtest.hh)

Running one suite: FeaturesReporterTests
Test suite: FeaturesReporterTests (test/protocols/features/FeaturesReporterTests.cxxtest.hh)

Running one suite: LimitAromaChi2OperationTests
Test suite: LimitAromaChi2OperationTests (test/protocols/toolbox/task_operations/LimitAromaChi2Operation.cxxtest.hh)

Running one suite: HotspotHashingTests
Test suite: HotspotHashingTests (test/protocols/hotspot_hashing/hotspot_hashing.cxxtest.hh)

Running one suite: LoopsTest
Test suite: LoopsTest (test/protocols/loops/Loops.cxxtest.hh)

Running one suite: ScoreNormalizationTest
Test suite: ScoreNormalizationTest (test/protocols/qsar/scoring_grid/ScoreNormalization.cxxtest.hh)

Running one suite: GraftingTest
Test suite: GraftingTest (test/protocols/grafting/GraftingTest.cxxtest.hh)

Running one suite: TypesetMoversTests
Test suite: TypesetMoversTests (test/protocols/moves/TypesetMovers.cxxtest.hh)

Running one suite: LigInterfaceConstraintsTest
Test suite: LigInterfaceConstraintsTest (test/protocols/enzdes/LigInterfaceConstraints.cxxtest.hh)

Running one suite: SegmentSwapTests
Test suite: SegmentSwapTests (test/protocols/forge/build/SegmentSwap.cxxtest.hh)

Running one suite: PseudocontactShiftTests
Test suite: PseudocontactShiftTests (test/protocols/abinitio/PseudocontactShiftEnergy.cxxtest.hh)

Running one suite: ProteinInterfaceDesignOperationTests
Test suite: ProteinInterfaceDesignOperationTests (test/protocols/toolbox/task_operations/ProteinInterfaceDesignOperation.cxxtest.hh)

Running one suite: RemodelConstraintGeneratorTest
Test suite: RemodelConstraintGeneratorTest (test/protocols/forge/remodel/RemodelConstraintGenerator.cxxtest.hh)

Running one suite: SmallMoverTest
Test suite: SmallMoverTest (test/protocols/moves/SmallMover.cxxtest.hh)

Running one suite: LoophashTest
Test suite: LoophashTest (test/protocols/loophash/loophash.cxxtest.hh)

Running one suite: Neighbor_CalculatorsTests
Test suite: Neighbor_CalculatorsTests (test/protocols/toolbox/pose_metric_calculators/Neighbor_Calculators.cxxtest.hh)

Running one suite: InterchainEnvEnergy
Test suite: InterchainEnvEnergy (test/protocols/scoring/InterchainEnvEnergy.cxxtest.hh)

Running one suite: BackrubMoverTest
Test suite: BackrubMoverTest (test/protocols/moves/BackrubMover.cxxtest.hh)

Running one suite: ddG
Test suite: ddG (test/protocols/simple_moves/ddG.cxxtest.hh)

Running one suite: FragmentMoverTest
Test suite: FragmentMoverTest (test/protocols/abinitio/FragmentMover.cxxtest.hh)

Running one suite: ChunkTest
Test suite: ChunkTest (test/protocols/nonlocal/Chunk.cxxtest.hh)

Running one suite: LoopsFileFallbackConfigurationTest
Test suite: LoopsFileFallbackConfigurationTest (test/protocols/loops/LoopsFileFallbackConfiguration.cxxtest.hh)

Running one suite: SetupDockingFoldTree
Test suite: SetupDockingFoldTree (test/protocols/docking/SetupDockingFoldTree.cxxtest.hh)

Running one suite: CalculatorFilterTests
Test suite: CalculatorFilterTests (test/protocols/filters/CalculatorFilter.cxxtest.hh)

Running one suite: RRReporterTests
Test suite: RRReporterTests (test/protocols/rotamer_recovery/RRReporter.cxxtest.hh)

Running one suite: TotalSasaFilterTests
Test suite: TotalSasaFilterTests (test/protocols/simple_filters/TotalSasaFilter.cxxtest.hh)

Running one suite: ProteinUpstreamBuilderTests
Test suite: ProteinUpstreamBuilderTests (test/protocols/match/ProteinUpstreamBuilder.cxxtest.hh)

Running one suite: ArithmeticTests
Test suite: ArithmeticTests (test/protocols/optimize_weights/Arithmetic.cxxtest.hh)

Running one suite: RRComparerTests
Test suite: RRComparerTests (test/protocols/rotamer_recovery/RRComparer.cxxtest.hh)

Running one suite: MoversTest
Test suite: MoversTest (test/protocols/moves/MoversTest.cxxtest.hh)

Running one suite: ConnectRightTests
Test suite: ConnectRightTests (test/protocols/forge/build/ConnectRight.cxxtest.hh)

Running one suite: RigidBodyMoverTests
Test suite: RigidBodyMoverTests (test/protocols/rigid/RigidBodyMover.cxxtest.hh)

Running one suite: MatchConsolidatorTests
Test suite: MatchConsolidatorTests (test/protocols/match/MatchConsolidator.cxxtest.hh)

Running one suite: MatchConstraintFileInfoTest
Test suite: MatchConstraintFileInfoTest (test/protocols/enzdes/MatchConstraintFileInfo.cxxtest.hh)

Running one suite: TorsionSamplingKinematicPerturberTests
Test suite: TorsionSamplingKinematicPerturberTests (test/protocols/moves/kinematic_closure/TorsionSamplingKinematicPerturber.cxxtest.hh)

Running one suite: DDGBindOptEDataTests
Test suite: DDGBindOptEDataTests (test/protocols/optimize_weights/DDGBindOptEData.cxxtest.hh)

Running one suite: GraphTests
Test suite: GraphTests (test/core/graph/Graph.cxxtest.hh)

Running one suite: SpartaTest
Test suite: SpartaTest (test/protocols/sparta/Sparta.cxxtest.hh)

Running one suite: FavorSequenceProfileTests
Test suite: FavorSequenceProfileTests (test/protocols/simple_moves/FavorSequenceProfile.cxxtest.hh)

Running one suite: SequenceAlignmentTests
Test suite: SequenceAlignmentTests (test/core/sequence/SequenceAlignment.cxxtest.hh)

Running one suite: DynamicAggregateFunctionTests
Test suite: DynamicAggregateFunctionTests (test/protocols/pack_daemon/DynamicAggregateFunction.cxxtest.hh)
~DoubleLazyIG: used 0 bytes instead of 5412
~DoubleLazyIG: used 0 bytes instead of 5412
~DoubleLazyIG: used 0 bytes instead of 5412
~DoubleLazyIG: used 0 bytes instead of 5412
~DoubleLazyIG: used 0 bytes instead of 5412
~DoubleLazyIG: used 0 bytes instead of 5412
~DoubleLazyIG: used 0 bytes instead of 5412
~DoubleLazyIG: used 0 bytes instead of 5412
~DoubleLazyIG: used 0 bytes instead of 5412
~DoubleLazyIG: used 0 bytes instead of 5412

Running one suite: ProteinSilentReportTests
Test suite: ProteinSilentReportTests (test/protocols/features/ProteinSilentReportTests.cxxtest.hh)

Running one suite: SequenceProfile_Tests
Test suite: SequenceProfile_Tests (test/core/sequence/SequenceProfile.cxxtest.hh)

Running one suite: ResidueTorsionRestraintsTest
Test suite: ResidueTorsionRestraintsTest (test/protocols/ligand_docking/ResidueTorsionRestraints.cxxtest.hh)

Running one suite: SplineFuncTests
Test suite: SplineFuncTests (test/core/scoring/constraints/SplineFunc.cxxtest.hh)

Running one suite: DisjointSetsTests
Test suite: DisjointSetsTests (test/core/graph/DisjointSets.cxxtest.hh)

Running one suite: AntibodyInfoTest
Test suite: AntibodyInfoTest (test/protocols/antibody/AntibodyInfo.cxxtest.hh)

Running one suite: RelativeConnectRightTests
Test suite: RelativeConnectRightTests (test/protocols/forge/build/RelativeConnectRight.cxxtest.hh)

Running one suite: BranchAngleOptimizerTest
Test suite: BranchAngleOptimizerTest (test/protocols/branch_angle/BranchAngleOptimizer.cxxtest.hh)

Running one suite: ThreadingMover_Tests
Test suite: ThreadingMover_Tests (test/protocols/comparative_modeling/ThreadingMover.cxxtest.hh)

Running one suite: PDBPoseMapTests
Test suite: PDBPoseMapTests (test/core/pose/PDBPoseMap.cxxtest.hh)

Running one suite: BigBinConstraintTests
Test suite: BigBinConstraintTests (test/core/scoring/constraints/BigBinConstraint.cxxtest.hh)

Running one suite: RotamerBuildingFunctionsTests
Test suite: RotamerBuildingFunctionsTests (test/core/pack/rotamer_set/rotamer_building_functions.cxxtest.hh)

Running one suite: HBPolyTest
Test suite: HBPolyTest (test/core/scoring/hbonds/polynomial.cxxtest.hh)

Running one suite: HeaderInformationTests
Test suite: HeaderInformationTests (test/core/io/pdb/HeaderInformationTests.cxxtest.hh)

Running one suite: DdgFilter
Test suite: DdgFilter (test/protocols/simple_filters/DdgFilter.cxxtest.hh)

Running one suite: RotamerTrials
Test suite: RotamerTrials (test/core/pack/RotamerTrials.cxxtest.hh)

Running one suite: ClusterTests
Test suite: ClusterTests (test/protocols/antibody/clusters/ClusterTests.cxxtest.hh)

Running one suite: CartGridTest
Test suite: CartGridTest (test/core/grid/CartGrid.cxxtest.hh)

Running one suite: ABEGOManagerTest
Test suite: ABEGOManagerTest (test/core/util/ABEGOManager.cxxtest.hh)

Running one suite: FASTERAnnealerTests
Test suite: FASTERAnnealerTests (test/core/pack/annealer/FASTERAnnealer.cxxtest.hh)

Running one suite: ConstraintsEnergyTests
Test suite: ConstraintsEnergyTests (test/core/scoring/constraints/ConstraintsEnergy.cxxtest.hh)

Running one suite: ProClosureEnergyTests
Test suite: ProClosureEnergyTests (test/core/scoring/methods/ProClosureEnergy.cxxtest.hh)

Running one suite: EnergyMapTest
Test suite: EnergyMapTest (test/core/scoring/EnergyMap.cxxtest.hh)

Running one suite: SymmetricRotamerTrials
Test suite: SymmetricRotamerTrials (test/core/pack/SymmetricRotamerTrials.cxxtest.hh)

Running one suite: ConformationTests
Test suite: ConformationTests (test/core/conformation/Conformation.cxxtest.hh)

Running one suite: HPatchInteractionGraphTests
Test suite: HPatchInteractionGraphTests (test/core/pack/interaction_graph/HPatchInteractionGraph.cxxtest.hh)

Running one suite: EtableUnModifyPotTests
Test suite: EtableUnModifyPotTests (test/core/scoring/etable/EtableUnModifyPot.cxxtest.hh)

Running one suite: MMTorsionLibraryTests
Test suite: MMTorsionLibraryTests (test/core/scoring/mm/MMTorsionLibrary.cxxtest.hh)

Running one suite: min_pack_Tests
Test suite: min_pack_Tests (test/core/pack/min_pack.cxxtest.hh)

Running one suite: AtomTreeDiffTests
Test suite: AtomTreeDiffTests (test/core/io/atom_tree_diffs/atom_tree_diff.cxxtest.hh)

Running one suite: MoveMapTest
Test suite: MoveMapTest (test/core/kinematics/MoveMap.cxxtest.hh)

Running one suite: rtmin_setup_Tests
Test suite: rtmin_setup_Tests (test/core/pack/scmin/rtmin_setup.cxxtest.hh)

Running one suite: InvrotTreeTest
Test suite: InvrotTreeTest (test/protocols/match_enzdes_util/InvrotTree.cxxtest.hh)

Running one suite: ConstraintUtilTests
Test suite: ConstraintUtilTests (test/core/scoring/constraints/util.cxxtest.hh)

Running one suite: HBondCalculatorsTest
Test suite: HBondCalculatorsTest (test/protocols/enzdes/HBondCalculatorsTest.cxxtest.hh)

Running one suite: P_AA_pp_EnergyTests
Test suite: P_AA_pp_EnergyTests (test/core/scoring/methods/P_AA_pp_Energy.cxxtest.hh)

Running one suite: DockingTest
Test suite: DockingTest (test/protocols/docking/DockingTest.cxxtest.hh)

Running one suite: PoseUtilTests
Test suite: PoseUtilTests (test/core/pose/util.cxxtest.hh)

Running one suite: EnvSmoothEnergyTests
Test suite: EnvSmoothEnergyTests (test/core/scoring/methods/EnvSmoothEnergy.cxxtest.hh)

Running one suite: TableVsAnalyticEtableTests
Test suite: TableVsAnalyticEtableTests (test/core/scoring/etable/TableVsAnalyticEtable.cxxtest.hh)

Running one suite: ArrayPoolTests
Test suite: ArrayPoolTests (test/core/graph/ArrayPool.cxxtest.hh)

Running one suite: NVlookupTests
Test suite: NVlookupTests (test/core/scoring/nv/NVlookup.cxxtest.hh)

Running one suite: ResfileAutoRemapTest
Test suite: ResfileAutoRemapTest (test/protocols/enzdes/ResfileAutoRemap.cxxtest.hh)

Running one suite: ChainbreakEnergyTests
Test suite: ChainbreakEnergyTests (test/core/scoring/methods/ChainbreakEnergy.cxxtest.hh)

Running one suite: MetricValueIOTest
Test suite: MetricValueIOTest (test/core/util/MetricValueIO.cxxtest.hh)

Running one suite: RotamerConstraintDun2002Tests
Test suite: RotamerConstraintDun2002Tests (test/core/pack/dunbrack/RotamerConstraintDun2002.cxxtest.hh)

Running one suite: BBTorsionSRFDTest
Test suite: BBTorsionSRFDTest (test/core/fragment/BBTorsionSRFD.cxxtest.hh)

Running one suite: HBondsTest
Test suite: HBondsTest (test/core/scoring/hbonds/HBonds.cxxtest.hh)

Running one suite: RNA_FA_ElecEnergyTests
Test suite: RNA_FA_ElecEnergyTests (test/core/scoring/elec/RNA_FA_ElecEnergy.cxxtest.hh)

Running one suite: ScalarWeightedFuncTests
Test suite: ScalarWeightedFuncTests (test/core/scoring/constraints/ScalarWeightedFunc.cxxtest.hh)

Running one suite: FragmentConstantLengthTest
Test suite: FragmentConstantLengthTest (test/core/fragment/ConstantLengthFragments.cxxtest.hh)

Running one suite: PDBInfoTests
Test suite: PDBInfoTests (test/core/pose/PDBInfo.cxxtest.hh)

Running one suite: OopPuckMoverTest
Test suite: OopPuckMoverTest (test/protocols/simple_moves/oop/OopPuckMover.cxxtest.hh)

Running one suite: ScoreTest
Test suite: ScoreTest (test/core/scoring/ScoreTest.cxxtest.hh)

Running one suite: AtomTests
Test suite: AtomTests (test/core/chemical/AtomTests.cxxtest.hh)

Running one suite: SequenceMappingTests
Test suite: SequenceMappingTests (test/core/sequence/SequenceMapping.cxxtest.hh)

Running one suite: FieldTests
Test suite: FieldTests (test/core/io/pdb/Field.cxxtest.hh)

Running one suite: HarmonicFuncTests
Test suite: HarmonicFuncTests (test/core/scoring/constraints/HarmonicFunc.cxxtest.hh)

Running one suite: MotifGraftMoverTests
Test suite: MotifGraftMoverTests (test/protocols/motif_grafting/MotifGraftMover.cxxtest.hh)
Start Test 1
Creating mover
Intializing mover
Importing Pose
Applying mover
End Test
Start Test 2
Creating mover
Intializing mover
Importing Pose
Applying mover
Mover Finished
End Test
Start Test 3
Creating mover
Intializing mover
Importing Pose
Applying mover
End Test
Start Test 4
Creating mover
Intializing mover
Importing Pose
Applying mover
End Test

Running one suite: PDB_IO
Test suite: PDB_IO (test/core/io/PDB_IO.cxxtest.hh)
Trace: "L[LEU_p:NtermProteinFull]DAPSQIEVKDVTDTTALITWFKPLAEIDGIELTYGIKDVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTT[THR_p:CtermProteinFull]"

Running one suite: PackerTaskTests
Test suite: PackerTaskTests (test/core/pack/task/PackerTask.cxxtest.hh)

Running one suite: UltraLightResidueTests
Test suite: UltraLightResidueTests (test/core/conformation/UltraLightResidue.cxxtest.hh)

Running one suite: EnvPairPotentialTest
Test suite: EnvPairPotentialTest (test/core/scoring/EnvPairPotential.cxxtest.hh)

Running one suite: SOGFuncTests
Test suite: SOGFuncTests (test/core/scoring/constraints/SOGFunc.cxxtest.hh)

Running one suite: HBondEnergyTests
Test suite: HBondEnergyTests (test/core/scoring/hbonds/HBondEnergy.cxxtest.hh)

Running one suite: GaussianFuncTests
Test suite: GaussianFuncTests (test/core/scoring/constraints/GaussianFunc.cxxtest.hh)

Running one suite: PDBSilentStruct_Tests
Test suite: PDBSilentStruct_Tests (test/core/io/silent/pdb_silent.cxxtest.hh)

Running one suite: ResidueTest
Test suite: ResidueTest (test/core/conformation/Residue.cxxtest.hh)

Running one suite: ElectronDensityLoaderTests
Test suite: ElectronDensityLoaderTests (test/core/scoring/electron_density/ElectronDensityLoader.cxxtest.hh)

Running one suite: AtomTreeCollectionTests
Test suite: AtomTreeCollectionTests (test/core/pack/scmin/AtomTreeCollection.cxxtest.hh)

Running one suite: BinaryProteinSilentTests
Test suite: BinaryProteinSilentTests (test/core/io/silent/binary_protein_silent.cxxtest.hh)

Running one suite: OccludedHbondSolEnergyTests
Test suite: OccludedHbondSolEnergyTests (test/core/scoring/geometric_solvation/OccludedHbondSolEnergy.cxxtest.hh)

Running one suite: FA_ElecEnergyTests
Test suite: FA_ElecEnergyTests (test/core/scoring/elec/FA_ElecEnergy.cxxtest.hh)

Running one suite: Resfile_Silent
Test suite: Resfile_Silent (test/core/pack/task/Resfile_Silent.cxxtest.hh)

Running one suite: ConformationAtomTest
Test suite: ConformationAtomTest (test/core/conformation/Atom.cxxtest.hh)

Running one suite: FullatomCustomPairDistanceEnergyTests
Test suite: FullatomCustomPairDistanceEnergyTests (test/core/scoring/custom_pair_distance/FullatomCustomPairDistanceEnergy.cxxtest.hh)

Running one suite: MMBondAngleLibraryTests
Test suite: MMBondAngleLibraryTests (test/core/scoring/mm/MMBondAngleLibrary.cxxtest.hh)

Running one suite: UnfoldedStateEnergyTests
Test suite: UnfoldedStateEnergyTests (test/core/scoring/methods/UnfoldedStateEnergy.cxxtest.hh)

Running one suite: FoldTreeTest
Test suite: FoldTreeTest (test/core/kinematics/FoldTree.cxxtest.hh)

Running one suite: SequenceUtilTests
Test suite: SequenceUtilTests (test/core/sequence/SequenceUtil.cxxtest.hh)

Running one suite: MMTorsionScoreTests
Test suite: MMTorsionScoreTests (test/core/scoring/mm/MMTorsionScore.cxxtest.hh)

Running one suite: SurfaceInteractionGraphTests
Test suite: SurfaceInteractionGraphTests (test/core/pack/interaction_graph/SurfaceInteractionGraph.cxxtest.hh)

Running one suite: AutomorphismTest
Test suite: AutomorphismTest (test/core/chemical/automorphism.cxxtest.hh)

Running one suite: CartesianBondedEnergyTests
Test suite: CartesianBondedEnergyTests (test/core/scoring/methods/CartesianBondedEnergy.cxxtest.hh)
START SCORE: 26.87406665551287

Running one suite: HBondsForDemos
Test suite: HBondsForDemos (test/core/scoring/hbonds/HBondsForDemos.cxxtest.hh)
#Dch Dn Dres Da  Ach An Ares Aa  length AHDang BAHang  BAtor weight energy
#A    5  GLN  N  A    1  ASN  O    2.03  153.9  154.4 -143.8  1.000 -0.731
#A    6  TRP  N  A    2  LEU  O    2.19  142.9  142.5 -149.9  1.000 -0.690
#A    7  LEU  N  A    3  TYR  O    2.03  146.5  141.5 -122.2  1.000 -0.579
#A    8  LYS  N  A    4  ILE  O    2.07  156.6  148.9 -115.6  1.000 -0.649
#A   11  GLY  N  A    6  TRP  O    2.37  144.0  141.8  162.9  1.000 -0.627
#A   10  GLY  N  A    7  LEU  O    1.86  147.9  109.2  -98.5  1.000 -0.349
#A   13  SER  N  A   10  GLY  O    2.06  146.5  136.3  126.4  1.000 -0.640
#A   14  SER  N  A   11  GLY  O    2.57  127.4  121.3 -129.7  1.000  0.000

Running one suite: SimpleInteractionGraphTests
Test suite: SimpleInteractionGraphTests (test/core/pack/interaction_graph/SimpleInteractionGraph.cxxtest.hh)

Running one suite: HBondDerivTest
Test suite: HBondDerivTest (test/core/scoring/hbonds/HBondDerivTest.cxxtest.hh)

Running one suite: AtomTypeSetTests
Test suite: AtomTypeSetTests (test/core/chemical/AtomTypeSet.cxxtest.hh)

Running one suite: VallTests
Test suite: VallTests (test/core/fragment/picking/vall/vall.cxxtest.hh)

Running one suite: MMAtomTypeSetTests
Test suite: MMAtomTypeSetTests (test/core/chemical/MMAtomTypeSet.cxxtest.hh)

Running one suite: RotamerSubsetsTest
Test suite: RotamerSubsetsTest (test/core/pack/rotamer_set/RotamerSubsets.cxxtest.hh)

Running one suite: FullatomDisulfideEnergyTests
Test suite: FullatomDisulfideEnergyTests (test/core/scoring/disulfides/FullatomDisulfideEnergy.cxxtest.hh)

Running one suite: AtomPairConstraintTests
Test suite: AtomPairConstraintTests (test/core/scoring/constraints/AtomPairConstraint.cxxtest.hh)

Running one suite: UnfoldedStatePotentialTests
Test suite: UnfoldedStatePotentialTests (test/core/scoring/UnfoldedStatePotential.cxxtest.hh)

Running one suite: SymmetricMinimizerTests
Test suite: SymmetricMinimizerTests (test/core/optimization/symmetry/SymmetricMinimizer.cxxtest.hh)

Running one suite: CenRotModelEnergyTests
Test suite: CenRotModelEnergyTests (test/core/scoring/cenrot/CenRotEnergy.cxxtest.hh)
38.630002145584

Running one suite: UtilTest
Test suite: UtilTest (test/core/fragment/util.cxxtest.hh)

Running one suite: RamachandranEnergyTests
Test suite: RamachandranEnergyTests (test/core/scoring/methods/RamachandranEnergy.cxxtest.hh)

Running one suite: ResfileReaderTests
Test suite: ResfileReaderTests (test/core/pack/task/ResfileReader.cxxtest.hh)

Running one suite: ResidueTypeBloatTests
Test suite: ResidueTypeBloatTests (test/core/chemical/ResidueTypeBloatTests.cxxtest.hh)

Running one suite: PoseTests
Test suite: PoseTests (test/core/pose/Pose.cxxtest.hh)

Running one suite: MinimizerTests
Test suite: MinimizerTests (test/core/optimization/Minimizer.cxxtest.hh)

Running one suite: PoseFromPDBLoaderTests
Test suite: PoseFromPDBLoaderTests (test/core/import_pose/PoseFromPDBResourceLoader.cxxtest.hh)

Running one suite: SymmetricScoreTest
Test suite: SymmetricScoreTest (test/core/scoring/symmetry/SymmetricScoreTest.cxxtest.hh)

Running one suite: SasaTests
Test suite: SasaTests (test/core/scoring/sasa.cxxtest.hh)

Running one suite: CartesianBondedEnergyBBDepTests
Test suite: CartesianBondedEnergyBBDepTests (test/core/scoring/methods/CartesianBondedEnergyBBDep.cxxtest.hh)
START SCORE: 26.9295125998115

Running one suite: VDW_EnergyTests
Test suite: VDW_EnergyTests (test/core/scoring/vdwaals/VDW_Energy.cxxtest.hh)

Running one suite: ResidueTypeTests
Test suite: ResidueTypeTests (test/core/chemical/ResidueTypeTests.cxxtest.hh)

Running one suite: DihedralConstraintTests
Test suite: DihedralConstraintTests (test/core/scoring/constraints/DihedralConstraint.cxxtest.hh)

Running one suite: ScoreFunctionUtilityTest
Test suite: ScoreFunctionUtilityTest (test/core/scoring/ScoreFunction.cxxtest.hh)

Running one suite: SCMinMultifuncTests
Test suite: SCMinMultifuncTests (test/core/pack/scmin/SCMinMultifunc.cxxtest.hh)

Running one suite: SymmetricConformationTests
Test suite: SymmetricConformationTests (test/core/conformation/symmetry/SymmetricConformation.cxxtest.hh)

Running one suite: ScoringSchemeTests
Test suite: ScoringSchemeTests (test/core/sequence/ScoringSchemes.cxxtest.hh)

Running one suite: RotamerRecoveryTests
Test suite: RotamerRecoveryTests (test/protocols/rotamer_recovery/RotamerRecovery.cxxtest.hh)

Running one suite: RotamerSetsTests
Test suite: RotamerSetsTests (test/core/pack/rotamer_set/RotamerSet.cxxtest.hh)

Running one suite: ProteinSilentTests
Test suite: ProteinSilentTests (test/core/io/silent/protein_silent.cxxtest.hh)

Running one suite: HBondDatabaseTest
Test suite: HBondDatabaseTest (test/core/scoring/hbonds/HBondDatabaseTest.cxxtest.hh)

Running one suite: AtomTypeDatabaseIOTests
Test suite: AtomTypeDatabaseIOTests (test/core/chemical/AtomTypeDatabaseIOTests.cxxtest.hh)

Running one suite: HBondsFadeEnergy
Test suite: HBondsFadeEnergy (test/core/scoring/hbonds/HBondsFadeEnergy.cxxtest.hh)

Running one suite: YHHPlanarityEnergyTests
Test suite: YHHPlanarityEnergyTests (test/core/scoring/methods/YHHPlanarityEnergy.cxxtest.hh)

Running one suite: RmsUtilTest
Test suite: RmsUtilTest (test/core/scoring/rms_util.cxxtest.hh)

Running one suite: MMBondAngleScoreTests
Test suite: MMBondAngleScoreTests (test/core/scoring/mm/MMBondAngleScore.cxxtest.hh)

Running one suite: OrbitalTypeSetTests
Test suite: OrbitalTypeSetTests (test/core/chemical/orbitals/OrbitalTypeSet.cxxtest.hh)

Running one suite: RG_Energy_Tests
Test suite: RG_Energy_Tests (test/core/scoring/methods/RG_Energy.cxxtest.hh)

Running one suite: PairEnergyTests
Test suite: PairEnergyTests (test/core/scoring/methods/PairEnergy.cxxtest.hh)

Running one suite: IndependentBBTorsionSRFDTests
Test suite: IndependentBBTorsionSRFDTests (test/core/fragment/IndependentBBTorsionSRFD.cxxtest.hh)

Running one suite: MMBondAngleEnergyTests
Test suite: MMBondAngleEnergyTests (test/core/scoring/methods/MMBondAngleEnergy.cxxtest.hh)

Running one suite: BoundConstraintTests
Test suite: BoundConstraintTests (test/core/scoring/constraints/BoundConstraint.cxxtest.hh)

Running one suite: P_AA_EnergyTests
Test suite: P_AA_EnergyTests (test/core/scoring/methods/P_AA_Energy.cxxtest.hh)

Running one suite: ParticleSwarmMinimizerTests
Test suite: ParticleSwarmMinimizerTests (test/core/optimization/ParticleSwarmMinimizer.cxxtest.hh)

Running one suite: SiteConstraintTests
Test suite: SiteConstraintTests (test/core/scoring/constraints/SiteConstraint.cxxtest.hh)

Running one suite: EtableEnergyTests
Test suite: EtableEnergyTests (test/core/scoring/etable/EtableEnergy.cxxtest.hh)

Running one suite: Dunbrack2002Test
Test suite: Dunbrack2002Test (test/core/scoring/dunbrack/Dunbrack2002.cxxtest.hh)
start score: 64.81732806507786
end score: 64.19820006384315

Running one suite: GeometricSolEnergyTests
Test suite: GeometricSolEnergyTests (test/core/scoring/geometric_solvation/GeometricSolEnergy.cxxtest.hh)

Running one suite: Symmetric_Binary_Protein_Silent_File_Tests
Test suite: Symmetric_Binary_Protein_Silent_File_Tests (test/core/io/silent/symmetric_binary_protein_silent.cxxtest.hh)

Running one suite: TaskOperationsTests
Test suite: TaskOperationsTests (test/core/pack/task/operation/TaskOperations.cxxtest.hh)

Running one suite: NVscoreTests
Test suite: NVscoreTests (test/core/scoring/nv/NVscore.cxxtest.hh)

Running one suite: LinearChainbreakEnergyTests
Test suite: LinearChainbreakEnergyTests (test/core/scoring/methods/LinearChainbreakEnergy.cxxtest.hh)

Running one suite: UseBicubicInterpolationTest
Test suite: UseBicubicInterpolationTest (test/core/scoring/use_bicubic_interpolation.cxxtest.hh)

Running one suite: OrbitalTests
Test suite: OrbitalTests (test/core/chemical/OrbitalTests.cxxtest.hh)

Running one suite: FixHisTautomerTest
Test suite: FixHisTautomerTest (test/core/pack/task/fix_his_tautomer.cxxtest.hh)

Running one suite: StringResourceStreamTests
Test suite: StringResourceStreamTests (test/basic/resource_manager/locator/StringResourceStream.cxxtest.hh)

Running one suite: SymmDataLoaderTests
Test suite: SymmDataLoaderTests (test/core/conformation/symmetry/SymmDataLoader.cxxtest.hh)

Running one suite: OptionsSystemTests
Test suite: OptionsSystemTests (test/basic/options/options_system.cxxtest.hh)
1120 tid: in:file:s
1120 tid: in:s
1120 tid: s
1120 tid: in:file:asdfasdfasf:s
1120 tid: in:asdfasdfasf:s
1120 tid: asdfasdfasf:s

Running one suite: ResourceLoaderFactoryTests
Test suite: ResourceLoaderFactoryTests (test/basic/resource_manager/ResourceLoaderFactory.cxxtest.hh)

Running one suite: ResourceOptionsFactoryTests
Test suite: ResourceOptionsFactoryTests (test/basic/resource_manager/ResourceOptionsFactory.cxxtest.hh)

Running one suite: SymmLinMemInteractionGraphTests
Test suite: SymmLinMemInteractionGraphTests (test/core/pack/interaction_graph/SymmLinMemInteractionGraph.cxxtest.hh)

Running one suite: KDTreeTests
Test suite: KDTreeTests (test/numeric/kdtree/kdtree.cxxtest.hh)

Running one suite: FileSystemResourceLocatorTests
Test suite: FileSystemResourceLocatorTests (test/basic/resource_manager/locator/FileSystemResourceLocatorTests.cxxtest.hh)

Running one suite: VirtualResidueScoreTest
Test suite: VirtualResidueScoreTest (test/core/scoring/VirtualResidues.cxxtest.hh)

Running one suite: SphericalVectorTests
Test suite: SphericalVectorTests (test/numeric/sphericalVector.cxxtest.hh)

Running one suite: InteractionGraphFactoryTests
Test suite: InteractionGraphFactoryTests (test/core/pack/interaction_graph/InteractionGraphFactory.cxxtest.hh)
~DoubleLazyIG: used 0 bytes instead of 0
~DoubleLazyIG: used 0 bytes instead of 0

Running one suite: XYZVectorTests
Test suite: XYZVectorTests (test/numeric/xyzVector.cxxtest.hh)

Running one suite: CarbonHBondEnergyTests
Test suite: CarbonHBondEnergyTests (test/core/scoring/carbon_hbonds/CarbonHBondEnergy.cxxtest.hh)

Running one suite: ResidueTypeSetTests
Test suite: ResidueTypeSetTests (test/core/chemical/ResidueTypeSetTests.cxxtest.hh)

Running one suite: ScTests
Test suite: ScTests (test/core/scoring/sc.cxxtest.hh)

Running one suite: AngleConstraintTests
Test suite: AngleConstraintTests (test/core/scoring/constraints/AngleConstraint.cxxtest.hh)

Running one suite: Bicubic_spline_tests
Test suite: Bicubic_spline_tests (test/numeric/interpolation/spline/Bicubic_spline.cxxtest.hh)

Running one suite: bicubic_interpolation_function_tests
Test suite: bicubic_interpolation_function_tests (test/numeric/interpolation/spline/bicubic_interpolation_function.cxxtest.hh)
bicubic interpolation 12.1993 0.215261 -0.140183
bicubic interpolation 12.1993 0.215261 -0.140183
bicubic interpolation 12.1993 0.215261 -0.140183
dvaldx analytic 0.215261 and numeric 0.215261
bicubic interpolation 12.1993 0.215261 -0.140183
bicubic interpolation 12.1993 0.215261 -0.140183
dvaldy analytic -0.140183 and numeric -0.140183

Running one suite: AngleFunctionTests

Running one suite: agglomerative_hierarchical_clusteringTest
Test suite: AngleFunctionTests (test/numeric/angle_functions.cxxtest.hh)
Test suite: agglomerative_hierarchical_clusteringTest (test/numeric/agglomerative_hierarchical_clustering.cxxtest.hh)

Running one suite: NumericFunctionsTests
Test suite: NumericFunctionsTests (test/numeric/numeric.functions.cxxtest.hh)

Running one suite: FFTTests
Test suite: FFTTests (test/numeric/fourier/fft.cxxtest.hh)

Running one suite: RotamerDotsTests
Test suite: RotamerDotsTests (test/core/pack/interaction_graph/RotamerDots.cxxtest.hh)

Running one suite: XYZFunctionsTests
Test suite: XYZFunctionsTests (test/numeric/xyz.functions.cxxtest.hh)

Running one suite: OneDHistogramTests
Test suite: OneDHistogramTests (test/numeric/histograms/OneDHistogram.cxxtest.hh)

Running one suite: OrbitalsEnergyTests
Test suite: OrbitalsEnergyTests (test/core/scoring/orbitals/OrbitalsScore.cxxtest.hh)
test_orbital_deriv_check_w_total_flexibility_all: -6.91854
test_orbital_deriv_check_w_total_flexibility_pci_cation_pi: 7.00016e-07
test_orbital_deriv_check_w_total_flexibility_pci_pi_pi: -2.58663
test_orbital_deriv_check_w_total_flexibility_orbitals_hpol_bb: -4.28528
test_orbital_deriv_check_w_total_flexibility_pci_salt_bridge: 1.77869e-05
test_orbital_deriv_check_w_total_flexibility_pci_hbond: -0.0466415

Running one suite: SymmMinimalistInteractionGraphTests
Test suite: SymmMinimalistInteractionGraphTests (test/core/pack/interaction_graph/SymmMinimalistInteractionGraph.cxxtest.hh)

Running one suite: WeightedReservoirSamplerTest
Test suite: WeightedReservoirSamplerTest (test/numeric/random/WeightedReservoirSampler.cxxtest.hh)

Running one suite: XYZTripleTests
Test suite: XYZTripleTests (test/numeric/xyzTriple.cxxtest.hh)

Running one suite: ContactOrderEnergy_Tests
Test suite: ContactOrderEnergy_Tests (test/core/scoring/methods/ContactOrderEnergy.cxxtest.hh)

Running one suite: FASTERInteractionGraphTests
Test suite: FASTERInteractionGraphTests (test/core/pack/interaction_graph/FASTERInteractionGraph.cxxtest.hh)

Running one suite: TwoDHistogramTests
Test suite: TwoDHistogramTests (test/numeric/histograms/TwoDHistogram.cxxtest.hh)

Running one suite: ClusteringTreeNodeTest
Test suite: ClusteringTreeNodeTest (test/numeric/ClusteringTreeNode.cxxtest.hh)

Running one suite: StatisticsFunctionsTests
Test suite: StatisticsFunctionsTests (test/numeric/statistics.functions.cxxtest.hh)

Running one suite: BoundingBoxTests
Test suite: BoundingBoxTests (test/numeric/geometry/BoundingBox.cxxtest.hh)

Running one suite: MMTorsionEnergyTests
Test suite: MMTorsionEnergyTests (test/core/scoring/methods/MMTorsionEnergy.cxxtest.hh)

Running one suite: EulerAnglesTests
Test suite: EulerAnglesTests (test/numeric/EulerAngles.cxxtest.hh)

Running one suite: WeightedSamplerTests
Test suite: WeightedSamplerTests (test/numeric/random/WeightedSampler.cxxtest.hh)

Running one suite: HistogramTests
Test suite: HistogramTests (test/numeric/interpolation/Histogram.cxxtest.hh)

Running one suite: DistributionSamplerTest
Test suite: DistributionSamplerTest (test/numeric/random/DistributionSampler.cxxtest.hh)

Running one suite: XYZMatrixTests
Test suite: XYZMatrixTests (test/numeric/xyzMatrix.cxxtest.hh)

Running one suite: ScoreFunctionTest
Test suite: ScoreFunctionTest (test/core/scoring/ScoreFunction.cxxtest.hh)

Running one suite: PCATests
Test suite: PCATests (test/numeric/PCA.cxxtest.hh)

Running one suite: ReservoirSamplingTests
Test suite: ReservoirSamplingTests (test/numeric/random/reservoir_sample.cxxtest.hh)

Running one suite: DunbrackEnergyTests
Test suite: DunbrackEnergyTests (test/core/pack/dunbrack/DunbrackEnergy.cxxtest.hh)

Running one suite: HomogenousTransformTests
Test suite: HomogenousTransformTests (test/numeric/HomogeneousTransform.cxxtest.hh)

Running one suite: Cubic_spline_tests
Test suite: Cubic_spline_tests (test/numeric/interpolation/spline/Cubic_spline.cxxtest.hh)

Running one suite: InterpolateTest
Test suite: InterpolateTest (test/numeric/interpolate.cxxtest.hh)

Running one suite: ConversionsTests
Test suite: ConversionsTests (test/numeric/conversions.cxxtest.hh)

Running one suite: TricubicSplineTests
Test suite: TricubicSplineTests (test/numeric/interpolation/spline/TricubicSpline.cxxtest.hh)

Running one suite: CalculatorTest
Test suite: CalculatorTest (test/numeric/Calculator.cxxtest.hh)

Running one suite: ConstraintSetRemappingTests
Test suite: ConstraintSetRemappingTests (test/core/scoring/constraints/ConstraintSetRemapping.cxxtest.hh)

Running one suite: ColorUtilTests
Test suite: ColorUtilTests (test/numeric/color_util.cxxtest.hh)

Running one suite: QuaternionTests
Test suite: QuaternionTests (test/numeric/Quaternion.cxxtest.hh)

Running one suite: ProbUtil
Test suite: ProbUtil (test/numeric/prob_util.cxxtest.hh)

Running one suite: NumericUtilTests
Test suite: NumericUtilTests (test/numeric/util.cxxtest.hh)

Running one suite: OrderedFragSetTest
Test suite: OrderedFragSetTest (test/core/fragment/OrderedFragSet.cxxtest.hh)

Running one suite: RandomSystemTests
Test suite: RandomSystemTests (test/numeric/random.cxxtest.hh)

Running one suite: OptionCollectionTests
Test suite: OptionCollectionTests (test/utility/options/OptionCollection.cxxtest.hh)

Running one suite: MultiDimensionalHistogramTests
Test suite: MultiDimensionalHistogramTests (test/numeric/MultiDimensionalHistogram.cxxtest.hh)

Running one suite: SmallKeyVectorTests
Test suite: SmallKeyVectorTests (test/utility/keys/SmallKeyVector.cxxtest.hh)

Running one suite: SimulateMPITests
Test suite: SimulateMPITests (test/utility/simulate_mpi.cxxtest.hh)

Running one suite: Key4VectorTests
Test suite: Key4VectorTests (test/utility/keys/Key4Vector.cxxtest.hh)

Running one suite: FactoryTests
Test suite: FactoryTests (test/utility/factory/Factory.cxxtest.hh)

Running one suite: KeyMapTests
Test suite: KeyMapTests (test/utility/keys/ClassKeyMap.cxxtest.hh)

Running one suite: SmallKeyMapTests
Test suite: SmallKeyMapTests (test/utility/keys/SmallKeyMap.cxxtest.hh)

Running one suite: MinMaxTest
Test suite: MinMaxTest (test/utility/minmax.cxxtest.hh)

Running one suite: Key4TupleTests
Test suite: Key4TupleTests (test/utility/keys/Key4Tuple.cxxtest.hh)

Running one suite: IZStreamTests
Test suite: IZStreamTests (test/utility/io/izstream.cxxtest.hh)

Running one suite: PathNameTests
Test suite: PathNameTests (test/utility/file/PathName.cxxtest.hh)

Running one suite: in_place_listTests
Test suite: in_place_listTests (test/utility/in_place_list.cxxtest.hh)

Running one suite: Vector1BoolTests
Test suite: Vector1BoolTests (test/utility/vector1_bool.cxxtest.hh)

Running one suite: AutoKeyTests
Test suite: AutoKeyTests (test/utility/keys/AutoKey.cxxtest.hh)

Running one suite: Vector0Tests
Test suite: Vector0Tests (test/utility/vector0.cxxtest.hh)

Running one suite: PausableSignalHubTests
Test suite: PausableSignalHubTests (test/utility/signals/PausableSignalHub.cxxtest.hh)

Running one suite: heapTests
Test suite: heapTests (test/utility/heap.cxxtest.hh)

Running one suite: ZipStreamTests
Test suite: ZipStreamTests (test/utility/io/zipstream.cxxtest.hh)

Test Line 1
Test Line 2

Running one suite: TagTests
Test suite: TagTests (test/utility/tag/Tag.cxxtest.hh)

Running one suite: SCMinMinimizerMapTests
Test suite: SCMinMinimizerMapTests (test/core/pack/scmin/SCMinMinimizerMap.cxxtest.hh)

Running one suite: BufferedSignalHubTests
Test suite: BufferedSignalHubTests (test/utility/signals/BufferedSignalHub.cxxtest.hh)

Running one suite: BitVectorTests
Test suite: BitVectorTests (test/utility/BitVector.cxxtest.hh)

Running one suite: Vector1_Tests
Test suite: Vector1_Tests (test/utility/vector1.cxxtest.hh)

Running one suite: SignalHubTests
Test suite: SignalHubTests (test/utility/signals/SignalHub.cxxtest.hh)

Running one suite: FileSysUtilTests
Test suite: FileSysUtilTests (test/utility/file/file_sys_util.cxxtest.hh)

Running one suite: DatabaseSessionManagerTests
Test suite: DatabaseSessionManagerTests (test/utility/sql_database/DatabaseSessionManagerTests.cxxtest.hh)

Running one suite: UserKeyTests
Test suite: UserKeyTests (test/utility/keys/UserKey.cxxtest.hh)

Running one suite: OrderedTupleTests
Test suite: OrderedTupleTests (test/utility/OrderedTuple.cxxtest.hh)

Running one suite: UToolsTests
Test suite: UToolsTests (test/utility/UTools.cxxtest.hh)

Running one suite: KeyVectorTests
Test suite: KeyVectorTests (test/utility/keys/ClassKeyVector.cxxtest.hh)

Running one suite: RecentHistoryQueueTests
Test suite: RecentHistoryQueueTests (test/utility/recent_history_queue.cxxtest.hh)

Running one suite: TokenHubTests
Test suite: TokenHubTests (test/utility/signals/TokenHub.cxxtest.hh)

Running one suite: AccessPtrTests
Test suite: AccessPtrTests (test/utility/pointer/access_ptr.cxxtest.hh)

Running one suite: integer_mappingTests
Test suite: integer_mappingTests (test/utility/integer_mapping.cxxtest.hh)

Running one suite: StringUtilTests
Test suite: StringUtilTests (test/utility/string_util.cxxtest.hh)

Running one suite: OwningPtrTests
Test suite: OwningPtrTests (test/utility/pointer/owning_ptr.cxxtest.hh)

Running one suite: SurfacePotentialTests
Test suite: SurfacePotentialTests (test/core/scoring/SurfacePotential.cxxtest.hh)

Running one suite: VectorLTests
Test suite: VectorLTests (test/utility/vectorL.cxxtest.hh)

Running one suite: IterUtilTest
Test suite: IterUtilTest (test/utility/iter_util.cxxtest.hh)

Running one suite: LexicographicalIteratorTests
Test suite: LexicographicalIteratorTests (test/utility/LexicographicalIterator.cxxtest.hh)

Running one suite: BitSetTests
Test suite: BitSetTests (test/utility/BitSet.cxxtest.hh)

Running one suite: OwningPtrMITests
Test suite: OwningPtrMITests (test/utility/pointer/owning_ptr_MI.cxxtest.hh)

Running one suite: LigandDockTest
Test suite: LigandDockTest (test/apps/public/ligand_docking/ligand_dock.cxxtest.hh)

Running one suite: VarSolDRotamerDotsTest
Test suite: VarSolDRotamerDotsTest (test/devel/vardist_solaccess/VarSolDRotamerDots.cxxtest.hh)

Running one suite: ZnHashTests
Test suite: ZnHashTests (test/devel/znhash/ZnHash.cxxtest.hh)

trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.RestrictNonSurfaceToRepackingOperationTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.FragmentCandidatesTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.EntityCorrespondenceTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.RestrictToCDRH3LoopTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.LoopsFileIOTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.JD2ResourceManagerJobInputterMultipleJobTagsTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.RigidLigandBuilderTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.ExtraThreadingMover_Tests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.LoopTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.InterchainPairEnergy.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.GrowLeftTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.cout_io.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.GrowRightTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.ReplicateFilterTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.SegmentInsertTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.ProteinInterfaceDesignTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.LigandConformerTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.PredockRotCenterTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.PointMutScanDriverTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.AtomCoordinateCstMoverTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.CM_Util_Tests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.JumpingTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.TaskAwareMinMoverTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.OccupiedSpaceHashTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.LoopsFoldTreeTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.JD2ResourceManagerJobInputterSimplifiedInputTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.NonlocalUtilTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.CoordSerializationTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.WobbleMoverTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.IfThenFilterTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.PseudocontactShiftTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.ScoreTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.InterfaceTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.RestrictOperationsTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.fold_tree_functions_Tests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.ScaffoldBuildPointTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.APClusterTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.RotateJumpAxisMoverTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.GraftingTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.ShearMoverTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.GunnCostTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.ResidueCountFilterTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.SegmentRebuildTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.DsspTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.JD2ResourceManagerJobInputterTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.ProteinSCSamplerTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.VoxelSetIteratorTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.HasherTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.TorsionBinIOTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.BluePrintTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.BumpGridTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.LoopsFileLoaderTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.FeaturesReporterTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.LimitAromaChi2OperationTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.RegionTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.LoopsUtilTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.VicinitySamplingKinematicPerturberTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.BuildManagerTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.HotspotHashingTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.PackDaemonTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.ExternalGeomSamplerTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.BridgeTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.RemodelConstraintGeneratorTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.JD2ResourceManagerTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.ContainerMoversTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.LoopsTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.SmallMoverTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.AntibodyInfoTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.EntityTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.TypesetMoversTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.FragmentMoverTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.PlainSilentFileJobDistributorTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.ScoreNormalizationTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.ProteinInterfaceDesignOperationTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.LigInterfaceConstraintsTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.ddG.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.LoopsFileOptionsTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.BetaTurnDetectionFeaturesTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.LoophashTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.Neighbor_CalculatorsTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.SegmentSwapTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.BackrubMoverTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.OopPuckMoverTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.RigidBodyMoverTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.DockingTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.SetupDockingFoldTree.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.DDGBindOptEDataTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.SpartaTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.DynamicAggregateFunctionTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.TotalSasaFilterTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.MoversTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.RRReporterTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.RRComparerTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.CalculatorFilterTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.InterchainEnvEnergy.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.ResidueTorsionRestraintsTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.ConnectRightTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.MatchConstraintFileInfoTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.ProteinSilentReportTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.FavorSequenceProfileTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.TorsionSamplingKinematicPerturberTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.ProteinUpstreamBuilderTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.ChunkTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.RotamerRecoveryTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.InvrotTreeTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.ClusterTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.LoopsFileFallbackConfigurationTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.ThreadingMover_Tests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.ResfileAutoRemapTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.ArithmeticTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.BranchAngleOptimizerTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.RelativeConnectRightTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.HBondCalculatorsTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.DdgFilter.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.MotifGraftMoverTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/protocols.test.MatchConsolidatorTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.RotamerTrials.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.RotamerBuildingFunctionsTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.GraphTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.HPatchInteractionGraphTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.BigBinConstraintTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.SequenceAlignmentTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.rtmin_setup_Tests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.SequenceProfile_Tests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.ConstraintsEnergyTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.ABEGOManagerTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.SymmetricRotamerTrials.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.ProClosureEnergyTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.SplineFuncTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.DisjointSetsTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.ConformationTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.AtomTreeDiffTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.FASTERAnnealerTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.EtableUnModifyPotTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.PDBPoseMapTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.HBPolyTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.MoveMapTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.HeaderInformationTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.P_AA_pp_EnergyTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.ConstraintUtilTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.CartGridTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.HBondsTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.FullatomCustomPairDistanceEnergyTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.ScoreTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.TableVsAnalyticEtableTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.PoseUtilTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.FragmentConstantLengthTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.EnvSmoothEnergyTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.EnergyMapTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.ChainbreakEnergyTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.PDBInfoTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.MMTorsionLibraryTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.min_pack_Tests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.BinaryProteinSilentTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.HBondEnergyTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.PackerTaskTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.RNA_FA_ElecEnergyTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.RotamerConstraintDun2002Tests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.AtomTreeCollectionTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.PDB_IO.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.UltraLightResidueTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.BBTorsionSRFDTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.PDBSilentStruct_Tests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.ArrayPoolTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.NVlookupTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.OccludedHbondSolEnergyTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.MetricValueIOTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.ResidueTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.MinimizerTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.SurfaceInteractionGraphTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.Resfile_Silent.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.ScalarWeightedFuncTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.FoldTreeTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.AtomTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.SequenceMappingTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.UnfoldedStateEnergyTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.SimpleInteractionGraphTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.AutomorphismTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.FieldTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.CartesianBondedEnergyTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.FA_ElecEnergyTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.HarmonicFuncTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.HBondsForDemos.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.RotamerSubsetsTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.FullatomDisulfideEnergyTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.EnvPairPotentialTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.CartesianBondedEnergyBBDepTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.SOGFuncTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.GaussianFuncTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.SymmetricMinimizerTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.RotamerSetsTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.ElectronDensityLoaderTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.SymmetricScoreTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.ResidueTypeBloatTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.AtomPairConstraintTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.RamachandranEnergyTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.ConformationAtomTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.CenRotModelEnergyTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.PoseTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.MMBondAngleLibraryTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.UnfoldedStatePotentialTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.SequenceUtilTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.MMTorsionScoreTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.ProteinSilentTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.PoseFromPDBLoaderTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.SasaTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.DihedralConstraintTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.ResidueTypeSetTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.ResfileReaderTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.VDW_EnergyTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.HBondDerivTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.SCMinMultifuncTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.AtomTypeSetTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.VallTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.MMAtomTypeSetTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.RmsUtilTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.EtableEnergyTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.UtilTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.SymmetricConformationTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.Symmetric_Binary_Protein_Silent_File_Tests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.P_AA_EnergyTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.RG_Energy_Tests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.PairEnergyTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.YHHPlanarityEnergyTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.MMBondAngleEnergyTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.Dunbrack2002Test.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.VirtualResidueScoreTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.ScTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.ResidueTypeTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.TaskOperationsTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.AtomTypeDatabaseIOTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.OrbitalsEnergyTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.NVscoreTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.LinearChainbreakEnergyTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.ScoreFunctionUtilityTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.SymmLinMemInteractionGraphTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.ScoringSchemeTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.InteractionGraphFactoryTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.HBondDatabaseTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.HBondsFadeEnergy.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.ContactOrderEnergy_Tests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.AngleConstraintTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.MMBondAngleScoreTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.OrbitalTypeSetTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.SymmMinimalistInteractionGraphTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.UseBicubicInterpolationTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.IndependentBBTorsionSRFDTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.FixHisTautomerTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.RotamerDotsTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.ScoreFunctionTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.BoundConstraintTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.ParticleSwarmMinimizerTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.MMTorsionEnergyTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.SiteConstraintTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.GeometricSolEnergyTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.ConstraintSetRemappingTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.SurfacePotentialTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.CarbonHBondEnergyTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.DunbrackEnergyTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.FASTERInteractionGraphTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.OrbitalTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.OrderedFragSetTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.SCMinMinimizerMapTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/core.test.SymmDataLoaderTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/basic.test.StringResourceStreamTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/basic.test.OptionsSystemTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/basic.test.ResourceLoaderFactoryTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/basic.test.ResourceOptionsFactoryTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/basic.test.FileSystemResourceLocatorTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.KDTreeTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.SphericalVectorTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.XYZVectorTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.Bicubic_spline_tests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.bicubic_interpolation_function_tests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.agglomerative_hierarchical_clusteringTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.NumericFunctionsTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.AngleFunctionTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.FFTTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.OneDHistogramTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.XYZFunctionsTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.WeightedReservoirSamplerTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.XYZTripleTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.ClusteringTreeNodeTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.TwoDHistogramTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.StatisticsFunctionsTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.BoundingBoxTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.WeightedSamplerTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.EulerAnglesTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.HistogramTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.DistributionSamplerTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.XYZMatrixTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.PCATests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.ReservoirSamplingTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.InterpolateTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.Cubic_spline_tests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.HomogenousTransformTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.ConversionsTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.TricubicSplineTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.CalculatorTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.ProbUtil.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.NumericUtilTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.QuaternionTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.ColorUtilTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.RandomSystemTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/numeric.test.MultiDimensionalHistogramTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.SmallKeyVectorTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.OptionCollectionTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.SimulateMPITests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.Key4VectorTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.KeyMapTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.FactoryTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.SmallKeyMapTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.Key4TupleTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.PathNameTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.MinMaxTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.IZStreamTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.in_place_listTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.Vector1BoolTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.AutoKeyTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.heapTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.ZipStreamTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.PausableSignalHubTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.Vector0Tests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.TagTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.Vector1_Tests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.SignalHubTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.BufferedSignalHubTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.FileSysUtilTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.BitVectorTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.DatabaseSessionManagerTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.UserKeyTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.OrderedTupleTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.KeyVectorTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.UToolsTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.integer_mappingTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.RecentHistoryQueueTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.AccessPtrTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.TokenHubTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.StringUtilTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.OwningPtrTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.VectorLTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.OwningPtrMITests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.LexicographicalIteratorTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.BitSetTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/utility.test.IterUtilTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/apps.test.LigandDockTest.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/devel.test.ZnHashTests.yaml
trying:  build/test/debug/linux/2.6/64/x86/gcc/4.4/default/devel.test.VarSolDRotamerDotsTest.yaml
-------- Unit test summary --------
Total number of tests: 1315
  number tests passed: 1315
  number tests failed: 0
Success rate: 100%
---------- End of Unit test summary
Done!